← All Tags

#privacy

86 episodes

#3137: Credit Scores vs. Israel: Two Ways to Quantify Trust

The US uses a private scoring machine. Israel uses a government data registry. Two radically different answers to the same question.

israelfinancial-fraudprivacy

#3090: How the Restaurant Was Born in 1760s Paris

The sit-down restaurant is only 260 years old. Before menus, you ate what the cook served.

political-historyurban-planningprivacy

#3036: Plainclothes Police vs Facial Recognition: Inside London's Protest Ops

How do plainclothes officers actually operate? From covert earpieces to unmarked vans, here's what happened at London's May 16 protests.

surveillance-technologyprivacyfacial-recognition

#3016: Sleeping with Strangers: Medieval Inn Life

Medieval inns weren't dirty hotels—they were legally regulated public utilities where you shared a bed with strangers.

privacysurveillance-technologyhistorical-linguistics

#2961: Podcast Analytics Without Selling Your Soul

Three paths to listener data that respect privacy and actually work with object storage.

privacyopen-sourcepodcast-analytics

#2892: Where Does Your Biometric Data Actually Live?

Linux, Windows, and the surprising tradeoffs of storing your face and fingerprints.

privacytrusted-execution-environmentsbiometric-storage

#2839: Full Disk Encryption: What It Actually Does and Why It Matters

Full disk encryption demystified — how LUKS works, performance reality, and when you actually need it.

data-securityhardware-engineeringprivacy

#2831: What VPNs Still Protect After HTTPS

HTTPS encrypts your content but leaves your metadata exposed. Here's what a VPN still protects.

vpnnetwork-securityprivacy

#2805: The Subprocessor Notification Nobody Reads

Why do companies send subprocessor update emails nobody reads? It's transparency theater — with a hidden purpose.

privacydata-securitysupply-chain-security

#2695: Self-Hosting Tailscale Exit Nodes Safely

How to safely route traffic through your home from anywhere using Tailscale exit nodes — without exposing your network.

networkingvpnprivacy

#2679: Can a VPN Protect You from SS7 Phone Spying?

SS7 is the hidden backbone of global phone networks—and it's wide open to spies. Here's what a VPN does and doesn't fix.

privacytelecommunicationssecurity

#2678: How IMSI Catchers Actually Track Your Phone

How fake cell towers intercept your phone, from GSM flaws to 5G fixes. Separating spy-thriller hype from real engineering.

surveillance-technologysecurityprivacy

#2671: How Your Phone Helps Strangers Find Lost Wallets

Your phone silently helps strangers find lost items. Here's how the cryptography and mesh networks actually work.

cryptographyprivacysustainability

#2604: Self-Hosted Screen Recording: Tools Beyond Loom

Practical tools and trade-offs for async video documentation with real data control across platforms including Linux.

open-sourceprivacyscreen-recording

#2587: Where to Draw the Line on DNS Blocking

DNS-level ad and tracker blocking compared — where each tool shines, where they fall short, and the real tradeoffs.

network-securityprivacyiot-protocols

#2586: Pseudo-Personalized Emails: The New Spam Uncanny Valley

How to detect and filter AI-generated outreach emails that fake personal connection without nuking legitimate messages.

social-engineeringprivacyprompt-engineering

#2547: Self-Hosted Podcast Analytics & Caching Fixes

How to track listeners, handle caching delays, and get sponsor-ready numbers when self-hosting on Cloudflare R2 or S3.

privacypodcast-analyticscache-busting

#2536: Self-Hosted Zapier Alternatives in 2026

n8n, Huginn, and Dagu compared for personal automation on your own hardware.

automationprivacyself-hosting

#2532: When the Internet Goes Dark: Censorship's Unseen Consequences

From Iran’s historic blackout to UK age verification laws — the global picture on pornography regulation is more complex than you think.

iraninternetprivacy

#2505: How Self-Hosted Search Actually Works for AI Agents

SearXNG isn't a crawler — it's a metasearch router. Here's how it works and why AI agents change everything.

ai-agentsopen-sourceprivacy

#2483: Substitution Anonymization: Privacy Without Utility Loss

How to generate realistic synthetic voice notes and calendar data with zero PII exposure risk.

small-language-modelsprivacymodel-collapse

#2423: How Leaders Hide Their Health: From Secret Yacht Surgeries to Falsified Reports

From secret yacht surgeries to falsified bulletins, how world leaders conceal medical conditions — and why it matters.

privacyhealthexecutive-protection

#2375: Monero: The Digital Cash That Hides Everything

How Monero’s privacy tech makes every transaction untraceable—and why that’s becoming essential in a world of financial surveillance.

privacycryptographyfinancial-privacy

#2373: How Facial Recognition Maps Your Face—And Your Rights

The same AI that organizes your photos can track you in a crowd. How does facial recognition work—and why is it so hard to evade?

privacydigital-privacysurveillance-technology

#2372: Choosing the Right Sandbox for Your Threat Model

Explore the tools and methods for creating secure, isolated environments to test malware, browse privately, and protect sensitive systems.

cybersecurityprivacyoperating-systems

#2324: The Three Layers of Filming in a Security-Conscious Country

Navigating the legal and social challenges of filming in Israel—what’s allowed, what’s not, and how creators can stay safe.

israelprivacysecurity

#2104: The Envelope Problem: Why Your VPN Isn't Enough

A VPN isn't magic. Learn how DNS and SNI leaks expose your browsing, and what encrypted DNS and ECH actually do to fix it.

privacycybersecuritynetwork-security

#1986: Desk Robots: Privacy, Power, or Annoyance?

These AI companions sit on your desk, watching your posture and listening in—so how do they protect your privacy while actually being useful?

ai-agentslocal-aiprivacy

#1960: The Microscopic Venetian Blinds in Your Screen

A coffee shop glance reveals a black slab, not your data. Discover the microscopic Venetian blinds making it possible.

privacydisplay-technologyhuman-computer-interaction

#1909: The Unbakeable Cake: AI's Copyright Problem

Why can't we just delete stolen data from AI models? It's not a database—it's a baked cake.

ai-ethicsprivacygenerative-ai

#1816: Is the Browser Finally Getting a Brain?

The browser is evolving from a static window into a collaborator that understands, organizes, and acts for you.

ai-agentshuman-computer-interactionprivacy

#1815: Escaping Chrome's Golden Cage: Vivaldi, Brave, Arc & Opera

Google Chrome dominates at 65% market share, but Manifest V3 is breaking ad blockers. Here's how Vivaldi, Brave, Arc, and Opera offer a way out.

privacydigital-privacyonline-privacy

#1814: Firefox vs. Chrome in 2026: The Privacy vs. AI Trade-off

Chrome dominates with 68% market share, but Firefox holds its ground with a privacy-first approach. We compare their 2026 performance, AI features,...

privacylocal-aiai-models

#1775: Why Some Cultures Guard Privacy and Others Share Everything

We explore why privacy feels like a human right to some cultures but a modern luxury to others.

privacydigital-privacyisrael

#1772: PGP vs. Gmail: Who Really Holds Your Keys?

You see a padlock icon and think your email is safe. But does end-to-end encryption actually protect you, or just create a false sense of security?

privacydigital-privacycryptography

#1770: The Smart Home Tax Is Bankrupting Enthusiasts

Home Assistant's flexibility has become a liability. We explore the usability crisis and the fragile architecture of modern enthusiast smart homes.

smart-homearchitectureprivacy

#1743: Why the SEC’s Climate Rule Vanished

The SEC’s landmark climate disclosure rule is gone. Here’s what happened, and why companies still have to report emissions.

2026sustainabilityprivacy

#1722: The Dark Web Is Smaller Than You Think

Forget the iceberg myth—the dark web is more like a tiny shed behind a skyscraper, with only 3 million users and 100k sites.

privacycybersecuritytor

#1721: AI Doxxing: Why Your Writing Style Is a Liability

AI tools now identify anonymous users by analyzing their unique writing patterns, making traditional privacy measures less effective.

privacydigital-privacyai-detection

#1719: Why Pattern Matching Fails for PII at Scale

Regex alone is brittle; NER is expensive. See how hybrid frameworks like Presidio balance speed and accuracy to stop data leaks.

privacycybersecurityosint

#1234: Why Hashing Fails: Building Context-Aware Redaction Pipelines

Learn how to bridge the "anonymization gap" and protect sensitive data without destroying its utility for analysis.

privacytokenizationdata-integrity

#1082: Stop Ruining Your Website Speed With Tracking Scripts

Stop slowing down your site with invasive trackers. Learn how to balance privacy and performance using edge-side and proxy-based analytics.

privacyarchitecturedata-integrity

#1079: When Thin Walls Betray Your Voice

How do you keep your voice private when walls are thin? Explore the high-tech muzzles and throat mics designed for the remote work era.

audio-processingprivacyhardware-engineering

#1077: Will Your Browser Replace Your OS for Local AI?

See how Web GPU and Web NN are turning your browser into a local AI engine, ending the era of complex DIY setups and protecting your privacy.

local-aiprivacybrowser-cached-models

#1074: The $200 Information Tax: Why News Bundling is Broken

Tired of hitting paywalls? We explore why a "Spotify for news" doesn't exist and how AI might finally force the industry to change.

ai-agentsprivacynetworking

#1071: Beyond the Kill Switch: Advanced Router VPN Routing

Stop breaking your smart home. Learn how to use domain-based split routing and WireGuard to gain surgical control over your network.

networkingprivacysmart-home

#1053: The Soul and the Shield: Mastering Signature Management

Learn how to stay safe in a high-threat world by reducing your physical and digital signature without losing your sense of identity.

privacysituational-awarenessexecutive-protection

#990: Radical Transparency vs. Trash Security

Is your trash a gold mine for identity thieves? Learn the essentials of physical InfoSec and how to properly destroy sensitive documents.

privacyphysical-securityfinancial-fraud

#985: Banking on Surveillance: The Secret History of KYC

How did opening a bank account become a security clearance? Trace the evolution of KYC from the 1970s to the age of AI surveillance.

surveillance-technologyprivacypolitical-historykyc-regulationsanti-money-laundering

#980: The Rosehill Audit: Mapping a Digital Footprint

From Linux automation to AI prompts, discover the digital blueprint of a modern systems builder in this deep-dive investigative audit.

prompt-engineeringprivacylocal-ai

#963: The Truth Behind Iran’s Digital Iron Curtain

How do we measure public opinion in a state where dissent is a crime? Explore the data behind Iran’s hidden social and political reality.

privacynetworkingdata-integrity

#960: Why Your $2,000 Smart TV Lags Like a Budget Phone

Why does a $2,000 TV struggle with basic menus? Discover the hidden "Smart TV Tax" and why your display's brain is often stuck in the past.

smart-homearchitectureprivacy

#952: Can Amateur Sleuths Outsmart the CIA?

Explore how OSINT evolved from a niche hobby into a billion-dollar industry that rivals state intelligence agencies in the modern age.

osintsituational-awarenessprivacy

#864: The Death of SaaS: Building Your Own Bespoke AI Tools

Stop paying for dozens of subscriptions. Learn how AI agents are allowing anyone to build custom, private software tailored to their exact needs.

ai-agentsprivacysoftware-development

#806: Digital Litter: The War on Automated Email Sequences

Tired of 20-part email sequences? Explore the legal and technical battle against aggressive digital marketing and "cognitive inbox fragmentation."

privacydigital-privacydrip-campaigns

#801: When Code Enforces What Courts Can't

Can blockchain fix bad landlords and hidden salaries? Explore how smart contracts and Zero-Knowledge Proofs are rebuilding trust in 2026.

smart-contractsprivacydata-integrity

#798: Beyond the Button: How AI Learns From Your Feedback

Ever wonder if your AI feedback actually matters? Discover how ratings shape global models and the privacy tech keeping your data safe.

fine-tuningprivacydata-integrity

#796: Can Your Data Legally Leave the Country?

Explore the shift from a global cloud to localized data sovereignty and why legal jurisdictions are the new physical borders of 2026.

privacynetworkingdata-sovereignty

#780: Escaping the Golden Cage: The Guide to De-Googling in 2026

Is it possible to leave Google in 2026? Explore the tools and trade-offs of reclaiming your digital sovereignty from the AI-driven golden cage.

privacydigital-sovereigntyde-googling

#776: Is Your Inbox Watching You Back?

A tiny 1x1 image is watching your every move. Explore how tracking pixels turn your inbox into a surveillance tool and how to fight back.

privacyfingerprintingemail-tracking

#774: Why Your Phone Fights You for Control

Tired of bloatware? Discover how to reclaim your mobile privacy in 2026, from hardened Android ROMs to the rise of true Linux on smartphones.

privacyopen-sourcehardware-durability

#724: The Surreal Evolution of Proving You’re Human

Why are CAPTCHAs asking us to identify cats with lightbulbs? Discover the invisible arms race between AI and digital gatekeeping.

cybersecurityprivacydigital-identity

#723: Domesticating Your Home Security: How to Kill the Cloud

Learn how to "domesticate" consumer security cameras by severing their cloud ties while keeping the high-quality hardware you love.

smart-homeprivacynetworking

#703: The Economics of Spam: Why It Pays to Be a Digital Mosquito

Why is your inbox overflowing? Explore the technical and economic reasons behind the relentless rise of digital and physical spam.

telecommunicationsprivacysocial-engineering

#659: Why Voice Is the Fusion Power of Biometrics

Explore why voice biometrics hasn't replaced Face ID and how generative AI is making "voice prints" a massive security risk.

privacysocial-engineeringbiometrics

#629: When Clouds Become Fingerprints

Every pixel is a secret. Herman and Corn discuss how AI and OSINT are turning clouds and shadows into a global tracking system.

privacygeolocationosint

#569: The End of the Blur: High-Res Satellites over Israel

From 2-meter blurs to 40cm clarity: Herman and Corn explore how shifting satellite laws are changing the face of Israeli security.

satellite-imagerysituational-awarenessprivacy

#564: Beyond the Factory Reset: How to Truly Erase Your Data

Think a factory reset protects your old data? Herman and Corn reveal why your digital "ghosts" might still be lurking on your old devices.

data-storagedata-securityprivacye-wastedigital-forensics

#557: Before They Can Click: The Ethics of Sharenting

Explore the ethical and technical landmines of sharing children's photos online, from metadata leaks to the rise of AI-generated deepfakes.

privacychild-developmentdigital-identity

#518: What Central Banks Actually Do All Day

Ever wonder why inflation targets exist? Herman and Corn demystify the Bank of Israel and the high-stakes world of central banking.

central-bankingdigital-currencyprivacy

#471: Who Owns Your Transaction History?

Is your credit card chip actually safe? Explore the hidden risks of shimming and why digital wallets have become the gold standard for security.

financial-fraudprivacyopen-banking

#468: The Math of a Room: LiDAR's Quiet Revolution

Discover how LiDAR is moving from expensive rigs to our pockets, bridging the gap between physical reality and digital models.

architectureprivacyspatial-computing

#384: The Whistleblower’s Shield: AI and the End of Scams

Can AI protect those who expose the truth? Explore the future of whistleblowing, from multi-million dollar bounties to anonymous digital twins.

financial-fraudwhistleblower-protectionprivacy

#381: Is Your Phone Hacking Itself?

Imagine getting hacked without ever clicking a link. Herman and Corn explore the terrifying world of zero-click exploits and Pegasus spyware.

privacyexecutive-protectionzero-day-exploits

#374: The Walls Have Eyes: The Reality of Hidden Travel Cameras

From power plugs to smoke detectors, hidden cameras are easier to hide than ever. Learn how to protect your privacy while traveling.

privacysmart-home

#223: The Myth of Unblockable Tech

When the grid goes dark, how do you get the truth out? Explore the high-stakes world of BGP hijacking, satellite jamming, and mesh networks.

networkingprivacy

#152: Dome vs. PTZ: The Hidden Tech of Baby Monitoring

Herman and Corn explore the best camera tech for tracking a crawling baby, from dual-lens systems to AI-powered motion detection.

baby-monitorhome-securityai-cameraptz-cameradual-lens

#150: Will AI Finally Shut Up Your Neighbor’s Car Horn?

Urban noise is more than an annoyance—it’s a health crisis. Discover how AI sensors are being used to silence the streets and the privacy costs.

noise-pollutionurban-noisehealthprivacysensors

#89: The Digital Twin Dilemma: Can AI Truly Understand You?

From "digital twins" to "digital nannies," Herman and Corn explore the engineering gap between smart encyclopedias and AI that knows your soul.

privacylocal-ailarge-language-models

#88: Why Won't My AI Talk to Me First?

Why is AI always waiting for us? Herman and Corn explore the technical and social hurdles of proactive AI and the "vending machine" model.

ai-agentsprivacystateless-architecture

#73: VPNs: Privacy Myth vs. Reality

VPNs: privacy savior or marketing hype? We expose the truth behind the grand claims and technical realities.

vpnsprivacysecuritydigital-privacyinternet-security

#71: Why Google Can't Crawl the Dark Web

Google's "dark web monitoring" isn't what you think. We reveal the hidden corners of the internet and Google's true capabilities.

dark-webgooglemonitoringdeep-webinternet-security

#59: The Watermark You Didn't Consent To

Invisible watermarks in AI? Is it privacy or protection? We uncover the hidden truth behind AI-generated content.

watermarksprivacysynthiddeepfakesconsent

#40: The Three Tribes of Local AI

Local AI: privacy, creativity, and compliance. Discover why keeping AI close to home is more than a trend.

local-aiprivacycompliancecreativitydata-privacy

#39: When Smaller AI Is Smarter

Forget LLMs. Discover SLMs: the specialized, efficient AI powerhouses transforming workflows, from planning to edge devices.

small-language-modelslocal-aiprivacy

#16: On Deepfakes, SynthID, And AI Watermarking

Deepfakes, SynthID, and AI watermarking. Could your AI creations be traced back to you?

privacydeepfake-detectionai-watermarking